PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G233400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 983aa    MW: 108711 Da    PI: 6.451
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G233400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.82.4e-41156233178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqve C adls+ak+yhrrhkvCe+hska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Manes.01G233400.1.p 156 VCQVEYCGADLSSAKDYHRRHKVCEMHSKASKALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTNP 233
                          6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.9E-33151218IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.188154231IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-38155236IPR004333Transcription factor, SBP-box
PfamPF031101.4E-29157230IPR004333Transcription factor, SBP-box
SuperFamilySSF484032.95E-7759868IPR020683Ankyrin repeat-containing domain
CDDcd002047.90E-7760867No hitNo description
Gene3DG3DSA:1.25.40.201.1E-5760870IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 983 aa     Download sequence    Send to blast
MEARFGGEAQ AYHFCRMGTT DMRAVGKRNL EWDLNDWKWD GDLFIASPLK PVPSGGMGRQ  60
LFPVTTGIPV NGNPSNSSSS CSDEVNPGIE NGKTELEKKR RAIVIEDDNL HGEEVGNLSL  120
KLGGHGFPII EREMGSWEGN SGKKTKVVGG RMSSAVCQVE YCGADLSSAK DYHRRHKVCE  180
MHSKASKALV GNVMQRFCQQ CSRFHVLQEF DEGKRSCRRR LAGHNKRRRK TNPEAVGNGT  240
SLNDERTSSY LLISLLRILS NLHSNRSDQV TDQDLLSHLL RSLASHSIQH GGRDISGLLQ  300
EPRDLLNDGT FGNSEQVVCA HGANGANMQT SCLVKPSIPN NYPAYSEVRD SSLGQVKMNN  360
FDLNDMYVDS DDGAEDIERS PVPTNMGTSS LDCPSWVQQD SHQSSPPQTS GNSDSASAQS  420
PSSSNGDAQS RTDRIIFKLF GKEPNDCPLV LRAQILDWLS HSPTDIESYI RPGCVILTVY  480
LRQAEATWEE LCCNLSSSLS RLLDVSDDAF WRTGWVYIRV QHQIAFVCNG QVVVDTSLPL  540
KSNNYSKILS VTPIAISASE RAQFVIKGIN LYRPTTRLLC AVEGTYMFQE NTQELMDSVD  600
NLKGYEELQC VNFCCSIPTV SGRGFIEIED HGFSNSYFPF IVAEEDVCSE IRMLESVLEL  660
GETDADAAGT GKMEAKNQAI DFIHEIGWLF HRSQLTSRLG HLDPCMDLFP LKRFKWLMEF  720
SMDHEWCAVV KKLLSILLKG VVGTGEHSSL NLALSELGLL HRAVRKNSRP LVELLLRYVP  780
GNAGPENKLL IEGSHDYNLF RPDVTGPAGL TPLHIAAGKD GSEDVLDALT EDPGMVGIKA  840
WKSARDSTGF TPEDYARLRG HYSYIHLVQK KINKRPAVGH VVLDIPGTLS DCSTNHKQNE  900
GVTTSFEIGQ TAVRPIQLPC KVCHQKLDYG SAGRSLLYRP AMLSMVAIAA VCVCVALLFK  960
SCPEVVYVFR PFRWELLDYG TS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-311562301084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012082979.10.0PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9S7P50.0SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBLA0A067K9350.0A0A067K935_JATCU; Uncharacterized protein
STRINGPOPTR_0002s18970.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1